WARNING: All products on this platform are strictly for laboratory research and in-vitro analytical testing purposes only. Not for human or veterinary administration or consumption. Under no circumstances should these materials be utilized for diagnostic or therapeutic applications.
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
Netherlands' #1 Source for Research Peptides
Free Xpresspost shipping on orders € 183,00& up
Trusted by 20,000+ Dutch Researchers
LL-37
LL-37
SKU:Immune Defense Support
Lion Peptides is a Dutch peptide manufacturer and supplier focused on premium research peptides, domestic production, quality-focused packaging, consistent labeled vial weight, and fast Netherlands-wide fulfillment.
Unlike many peptide suppliers that only ship from the Netherlands while sourcing finished vials from overseas, Lion Peptides focuses on true domestic peptide manufacturing, reliable research quality, transparent standards, and dependable Dutch customer support.
We ship research peptides across the Netherlands, including North Holland, South Holland, Utrecht, North Brabant, Gelderland, Overijssel, Limburg, Friesland, Groningen, Drenthe, Flevoland, and Zeeland.
Product Info
Molecular formula: C178H303N51O34
Molecular weight: 4493.0
Purity: 99%+
Sequence: [LL-37, 37 aa]
Most standard lyophilized research vials are commonly prepared using 2mL of bacteriostatic water unless otherwise specified directly on the product page or vial label.
For best handling, slowly add the bacteriostatic water down the inside wall of the vial rather than directly onto the powder. This helps reduce unnecessary agitation and supports product integrity during laboratory use.
After adding bacteriostatic water, gently swirl or roll the vial until the lyophilized powder has fully dissolved. Avoid aggressive shaking, as excessive agitation may affect product stability.
Prepared vials should typically be stored refrigerated between 2-8°C for best stability. Lyophilized vials that have not yet been prepared should be stored in a cool, dry environment away from direct sunlight, moisture, and excessive heat.
Proper storage and handling procedures are important for maintaining product purity, consistency, and reliability throughout laboratory applications.
Use our calculator for accurate concentration calculations, measurement planning, and preparation guidance:
Lion Peptides provides premium-quality research products, laboratory-use compounds, and analytical materials with fast Dutch shipping and strict quality control standards.
All products sold by Lion Peptides are intended strictly for research use only and are not intended for human consumption, medical use, analytical use, or any other unauthorized use.
Lyophilized research products should be stored in a cool, dry environment prior to preparation to help maintain long-term stability and purity.
Refrigeration is recommended for most products after opening. Prepared vials should remain refrigerated between 2-8°C and protected from repeated temperature changes.
Exposure to excessive moisture, heat, direct sunlight, or frequent freeze-thaw analytical batch may negatively impact product stability during laboratory applications.
Lion Peptides supplies high-purity research products, peptide blends, laboratory-use materials, and advanced analytical compounds manufactured with quality, consistency, and senon-clinical packaging in mind.
Proper storage and handling procedures are recommended to maintain product integrity, consistency, and analytical reliability throughout laboratory research environments.
What Are Peptides?
Peptides are short chains of amino acids commonly studied in laboratory and analytical research settings. They may be used to evaluate molecular structure, peptide stability, receptor interaction, biological signaling pathways, and compound behavior under controlled research conditions.
Different peptide compounds may be studied across categories such as peptide chemistry, cellular signaling, formulation testing, analytical comparison, compound stability, and protein interaction research.
Lion Peptides provides Dutch research peptides and laboratory-use compounds with a focus on purity, consistency, senon-clinical packaging, and fast Dutch fulfillment.
All products are supplied for laboratory research purposes only and should be handled in accordance with proper research standards and applicable regulations.
Shipping & Delivery
All orders are shipped from our Dutch fulfillment centre, helping customers across Nederland receive research products quickly and reliably.
Orders are typically processed within 24 hours from Monday to Friday. Delivery usually takes 2-5 business days, depending on your location, carrier availability, and the shipping method selected at checkout.
Once your order has shipped, you will receive a confirmation email with tracking information so you can monitor your package throughout transit.
Our fulfillment process is built around senon-clinical packaging, reliable handling, and fast Dutch shipping from checkout to delivery.
Payment Information
We currently accept senon-clinical payments via bank transfer, a commonly used payment method for Dutch customers.
After placing your order, you will automatically receive an email with clear payment instructions. Following the instructions carefully helps ensure your payment is matched to your order quickly and accurately.
Your order will be prepared and shipped once payment has been received and confirmed.
Need step-by-step guidance? .
Vial Specifications
Each vial contains peptides at approximately 104% of the labeled amount, helping support consistency for laboratory research applications.
Products are supplied in lyophilized, freeze-dried powder form. Lyophilization is commonly used to help preserve peptide stability during shipping and storage prior to preparation.
Our standard peptide vials are approximately 16mm in diameter and 38mm in height, with a maximum fill capacity of 3mL.
Peptides requiring preparation may be paired with bacteriostatic water for laboratory use. View bacteriostatic water .
We do not ship products in pre-mixed liquid form. Supplying products in lyophilized powder form helps support stability during transit and storage.
COAs & Lab Reports
Lion Peptides uses quality-control procedures designed to verify peptide purity, identity, and consistency before products are made available.
Testing may include analytical methods such as HPLC and Mass Spectrometry, which are commonly used in peptide quality verification to evaluate purity percentage, molecular identity, and batch consistency.
Certificates of Analysis, also known as COAs, can be provided upon request when available. These reports may include purity data, batch identification, and relevant analytical testing details.
Note: Due to laboratory processing times, batch turnover, supplier timelines, and the number of products offered, COAs may not always be immediately available for every batch.
You can also visit our COA reports page for available documentation.
Product Quality
Product quality is one of the most important factors when choosing a Dutch research peptide supplier. Lion Peptides focuses on sourcing high-purity compounds with consistent labeling, senon-clinical packaging, and reliable fulfillment.
Our catalog includes peptide blends, reference protein research compounds, mitochondrial research compounds, cosmetic peptide research materials, and other advanced laboratory-use products.
Each product page is designed to provide clear product details, molecular information when available, vial specifications, quality information, and product handling guidance.
We continue to improve our product pages, testing transparency, educational resources, and customer support to make Lion Peptides a trusted source for research products in the Netherlands.
Why Choose Lion Peptides?
Lion Peptides was built to provide Dutch customers with fast access to premium research products, clear product information, responsive support, and reliable fulfillment.
We focus on the details that matter: high-purity products, senon-clinical packaging, fast Dutch shipping, transparent communication, and a growing library of research-focused educational resources.
Whether you are looking for peptide research compounds, laboratory-use products, analytical materials, or advanced research compounds, our goal is to provide a smooth and professional ordering experience.
Lion Peptides is committed to becoming one of Nederland's most trusted online sources for research-use products.
Customer Support
Our team is available to help with order questions, tracking updates, payment instructions, product availability, COA requests, and general customer support.
If you need assistance before or after placing an order, you can contact us directly and we will do our best to respond as quickly as possible.
We aim to provide a professional, reliable, and transparent customer experience for every order placed through Lion Peptides.
Couldn't load pickup availability
Research Resources
Explore peptide testing, education, and research resources for the Dutch scientific community.
COA Reports
View available Certificates of Analysis and batch-specific peptide laboratory reports.
View Reports →Learning Centre
Take our research quiz and learn about peptides, laboratory handling, and research fundamentals.
Start Learning →Research Library
Explore Dutch peptide research articles, compound guides, education, and industry updates.
Explore Articles →Trending Products

Real customer experiences
Customer reviews
Read verified feedback and product experiences shared by our customers.
Based on 0 reviews
Purchased from us?
Share an honest review to help other customers shop with confidence.
Share your experience
Write a review
Tell us what stood out. Your feedback helps us improve and helps others make informed decisions.
You may also like
GHK-Cu
CJC-1295 + Ipamorelin (no DAC)
BPC-157
MOTS-c
BPC-157 + TB-500
AOD-9604
NAD+
Semax analytical formulation
MT-2 (Melanotan II)
Klow
Selank analytical formulation
Glow
MT-1 (Melanotan I)
KPV
DSIP
BPC-157 analytical units
Peptide X
SS-31
Kisspeptin
Epitalon
Ipamorelin
CJC-1295 + Ipamorelin analytical formulation
Glutathione
SLU-PP-332
5-Amino-1MQ
Pinealon
GLOW analytical formulation
Thymosin Alpha-1
BPC-157 + TB-500 analytical formulation
AOD-9604 analytical formulation
Melanotan 2 analytical formulation
BPC-157 analytical formulation
Cerebrolysin
SLU-PP-332 analytical units
KPV analytical units
Thymalin
GHRP-6
Epitalon analytical formulation
LL-37
VIP
Hexarelin
KPV analytical formulation
L-Carnitine
Cardarine analytical units
B12 (Cobalamin)
BAC Water
Laboratory Supplies
Alcohol Wipes
- Choosing a selection results in a full page refresh.
- Opens in a new window.